SRP72 (Center) rabbit polyclonal antibody, Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 126~156 amino acids from the Center region of Human SRP72 |
SRP72 (Center) rabbit polyclonal antibody, Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 126~156 amino acids from the Center region of Human SRP72 |
Rabbit Polyclonal Anti-SRP54 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SRP54 |
Rabbit Polyclonal Anti-SRP14 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRP14 antibody: synthetic peptide directed towards the N terminal of human SRP14. Synthetic peptide located within the following region: KPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLL |
Rabbit Polyclonal Anti-SRP68 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SRP68 |
Rabbit Polyclonal Anti-SRP19 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRP19 antibody: synthetic peptide directed towards the middle region of human SRP19. Synthetic peptide located within the following region: LCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKK |