Antibodies

View as table Download

Rabbit polyclonal RELA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA.

Rabbit Polyclonal Anti-BDNF

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor).

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

Rabbit polyclonal anti-HSPA1A(HSP70) antibody, Loading control

Applications IF, IHC, IP, WB
Reactivities Human, Mouse (Predicted: Sheep, Bovine)
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 308 and 569 of HSP70 1A

Rabbit polyclonal RELA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA.

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584]

Anti-MAP3K5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-14 amino acids of Human mitogen-activated protein kinase kinase kinase 5

Rabbit Polyclonal Anti-NGF Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NGF

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

Rabbit Polyclonal PAK2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PAK2 antibody was raised against a 14 amino acid peptide from near the amino terminus of human PAK2.

Rabbit Polyclonal c-Myc Antibody

Applications ChIP, ELISA, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106]

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Rat, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L).
Modifications Phospho-specific

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications Phospho-specific