Antibodies

Jump to Filters
View as table Download
PUF60 Rabbit Polyclonal Antibody
TA343804

USD 539.00

5 Days

Rabbit Polyclonal Anti-PUF60 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PUF60 antibody: synthetic peptide directed towards the C terminal of human PUF60. Synthetic peptide located within the following region: EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA
Hsc70 (HSPA8) Rabbit Polyclonal Antibody
TA346660

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE
HSP70-1A (HSPA1A) Rabbit Polyclonal Antibody
TA336829

USD 550.00

5 Days

Rabbit Polyclonal HSP70/HSPA1A Antibody

Applications Block/Neutralize, Electron Microscopy, FC, IHC, Simple Western, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminus portion of the human Hsp70 protein (between residues 600-641) [UniProt P08107]
PCBP1 Rabbit Polyclonal Antibody
TA345949

USD 539.00

5 Days

Rabbit Polyclonal Anti-PCBP1 Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PCBP1 antibody is: synthetic peptide directed towards the middle region of Human PCBP1. Synthetic peptide located within the following region: PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF
Aly (ALYREF) Rabbit Polyclonal Antibody
TA322556

USD 380.00

In Stock

Anti-ALYREF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 8-21 amino acids of human Aly/REF export factor
Acinus (ACIN1) Rabbit Polyclonal Antibody
TA324009

USD 380.00

In Stock

Anti-ACIN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1065-1080 amino acids of human apoptotic chromatin condensation inducer 1
Acinus (ACIN1) Rabbit Polyclonal Antibody
TA324010

USD 380.00

In Stock

Anti-ACIN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1065-1080 amino acids of human apoptotic chromatin condensation inducer 1
CDC5L Rabbit Polyclonal Antibody
TA349625

USD 380.00

In Stock

Rabbit Polyclonal Anti-CDC5L Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CDC5L
HSPA6 Rabbit Polyclonal Antibody
TA308406

USD 625.00

5 Days

Rabbit Polyclonal antibody to HSPA6 (heat shock 70kDa protein 6 (HSP70B'))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 377 and 628 of HSPA6 (Uniprot ID#P17066)
HNRNPC Rabbit Polyclonal Antibody
TA312153

USD 380.00

In Stock

Rabbit polyclonal hnRNP C1/C2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human hnRNP C1/C2.
TRA2A Rabbit Polyclonal Antibody
TA315400

USD 380.00

In Stock

Rabbit polyclonal anti-TRA-2a antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TRA-2a.
SAP155 (SF3B1) Rabbit Polyclonal Antibody
TA345713

USD 485.00

5 Days

Rabbit Polyclonal Anti-SF3B1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B1 antibody: synthetic peptide directed towards the N terminal of human SF3B1. Synthetic peptide located within the following region: MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR
hnRNP A1 (HNRNPA1) Rabbit Polyclonal Antibody
TA345790

USD 485.00

5 Days

Rabbit Polyclonal Anti-HNRPA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPA1 antibody: synthetic peptide directed towards the N terminal of human HNRPA1. Synthetic peptide located within the following region: MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN
SFRS3 (SRSF3) (C-term) Rabbit Polyclonal Antibody
AP31722PU-N

USD 535.00

2 Weeks

SFRS3 (SRSF3) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide from Human SFRS3.
hnRNP G (RBMX) Rabbit Polyclonal Antibody
TA350051

USD 380.00

In Stock

Rabbit Polyclonal Anti-RBMX Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RBMX