Antibodies

View as table Download

Rabbit Polyclonal Anti-CAV1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CAV1

Rabbit Polyclonal Anti-CAV1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAV1 antibody: synthetic peptide directed towards the N terminal of human CAV1. Synthetic peptide located within the following region: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID

Caveolin 1 (CAV1) (C-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide from C-terminal domain of human caveolin-1