Antibodies

View as table Download

INI1 Rabbit monoclonal antibody,clone OTIR2A11

Applications IHC
Reactivities Human
Conjugation Unconjugated

INI1 Rabbit monoclonal antibody,clone OTIR4G9

Applications IHC
Reactivities Human
Conjugation Unconjugated

INI1 Rabbit monoclonal antibody,clone OTIR2A11

Applications IHC
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

INI1 Rabbit monoclonal antibody,clone OTIR4G9

Applications IHC
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-SMARCB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SMARCB1

Rabbit anti-SMARCB1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SMARCB1

Rabbit Polyclonal Anti-SMARCB1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMARCB1 antibody: synthetic peptide directed towards the N terminal of human SMARCB1. Synthetic peptide located within the following region: RGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVT