INI1 Rabbit monoclonal antibody,clone OTIR2A11
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
INI1 Rabbit monoclonal antibody,clone OTIR2A11
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
INI1 Rabbit monoclonal antibody,clone OTIR4G9
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
INI1 Rabbit monoclonal antibody,clone OTIR2A11
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
INI1 Rabbit monoclonal antibody,clone OTIR4G9
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-SMARCB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SMARCB1 |
Rabbit anti-SMARCB1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SMARCB1 |
Rabbit Polyclonal Anti-SMARCB1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMARCB1 antibody: synthetic peptide directed towards the N terminal of human SMARCB1. Synthetic peptide located within the following region: RGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVT |