Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Rat, Xenopus, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit Polyclonal antibody to Inhibin beta A (inhibin, beta A)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Feline, Pig, Chicken, Sheep, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 362 and 426 of Inhibin beta A |
Rabbit Polyclonal Anti-SHH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Chicken |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT |
Periostin (POSTN) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, IHC, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Human OSF-2 Source of Antigen: E. coli. |
Rabbit Polyclonal Anti-LOXL2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human (Predicted: Mouse, Rat, Chicken) |
| Conjugation | Unconjugated |
| Immunogen | LOXL2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human LOXL2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Dog, Bovine, Bat, Elephant, Panda, Horse, Rabbit (100%); Mouse, Rat, Opossum, Turkey, Chicken, Platypus (93%); Xenopus, Pufferfish, Zebrafish, Stickleback (87%). |
ILEI / FAM3C Rabbit Polyclonal (aa40-80) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chimpanzee, Chicken, Dog, Human, Monkey, Mouse, Opossum, Rat, Pufferfish |
| Conjugation | Unconjugated |
| Immunogen | ILEI / FAM3C antibody was raised against synthetic peptide from human FAM3C. |
Anti-IGFBP-5 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Dog, Gorilla, Goat, Human, Monkey, Pig, Rabbit, Gibbon, Hamster, Horse (Predicted: Mouse, Rat, Chicken) |
| Conjugation | Unconjugated |
| Immunogen | IGFBP5 antibody was raised against human IGFBP5 amino acids 192-206 (CRRHMEASLQELKAS). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Bat, Bovine, Goat, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Mouse, Rat, Opossum, Chicken (93%); Marmoset (87%). |
Neuropeptide Y (NPY) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Chicken, Feline, Guinea Pig, Human, Rat, Zebrafish |
| Conjugation | Unconjugated |
WNT7A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Chicken, Dog, Xenopus, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%). |
WNT11 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chicken, Dog, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse |
| Conjugation | Unconjugated |
| Immunogen | WNT11 antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT11. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus (100%); Opossum, Stickleback (87%); Xenopus, Zebrafish (80%). |
Rabbit Polyclonal Anti-WNT1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human (Predicted: Chicken) |
| Conjugation | Unconjugated |
| Immunogen | WNT1 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Chicken (94%); Lizard (88%); Zebrafish (81%). |
Rabbit Polyclonal Anti-WNT2 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human (Predicted: Mouse, Rat, Bat, Bovine, Dog, Hamster, Pig, Rabbit, Sheep, Chicken, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | WNT2 / IRP antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset (100%); Galago, Mouse, Rat, Ferret, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Cat, Bat, Rabbit, Pig, Opossum, Guinea pig, Turkey, Chicken, Armadillo, Platypus (93%); Horse (87%). |
Germany
Japan
United Kingdom
China
