Antibodies

View as table Download

Rabbit Polyclonal Anti-IL1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IL1A

Rabbit polyclonal C1QC Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This C1QC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-120 amino acids from the Central region of human C1QC.

Rabbit polyclonal C1QC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human C1QC.

Rabbit polyclonal anti-C6 (complement component 6) antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human C6.

Rabbit Polyclonal Anti-C8B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C8B antibody: synthetic peptide directed towards the middle region of human C8B. Synthetic peptide located within the following region: WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSA

Rabbit Polyclonal Anti-C8B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C8B antibody: synthetic peptide directed towards the C terminal of human C8B. Synthetic peptide located within the following region: SGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTL

Rabbit Polyclonal Anti-C1QB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1QB antibody: synthetic peptide directed towards the C terminal of human C1QB. Synthetic peptide located within the following region: AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD