Antibodies

View as table Download

Rabbit polyclonal Retinoid X Receptor gamma antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Retinoid X Receptor ? antibody.

Rabbit polyclonal Retinoic Acid Receptor beta antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Retinoic Acid Receptor β.

Retinoid X Receptor gamma (RXRG) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 150-250 of Human RXRγ.

Rabbit Polyclonal Anti-RARB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RARB antibody: synthetic peptide directed towards the C terminal of human RARB. Synthetic peptide located within the following region: SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS