MMP3 rabbit polyclonal antibody, Immunoaffinity purified
| Applications | ICC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Carrier-protein conjugated synthetic peptide encompassing a sequence within the N-terminus region of human MMP3. The exact sequence is proprietary. |
Rabbit Polyclonal Anti-MMP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP3 antibody: synthetic peptide directed towards the middle region of human MMP3. Synthetic peptide located within the following region: SFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTN |
Rabbit Polyclonal Anti-MMP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP3 antibody: synthetic peptide directed towards the middle region of human MMP3. Synthetic peptide located within the following region: AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLN |
MMP3 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MMP3 |
Germany
Japan
United Kingdom
China
