Antibodies

Jump to Filters
View as table Download
PCK1 Rabbit Polyclonal Antibody
TA331175

USD 485.00

5 Days

Rabbit Polyclonal Anti-PCK1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS
PCK1 Rabbit Polyclonal Antibody
TA590679

USD 482.00

In Stock

Rabbit Polyclonal PCK1 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.