Antibodies

Jump to Filters
View as table Download
SF3B4 Rabbit Polyclonal Antibody
TA315039

USD 380.00

In Stock

Rabbit polyclonal anti-SF3B4 antibody

Applications IHC, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SF3B4.
SF3B4 Rabbit Polyclonal Antibody
TA345931

USD 485.00

5 Days

Rabbit Polyclonal Anti-SF3B4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B4 antibody: synthetic peptide directed towards the N terminal of human SF3B4. Synthetic peptide located within the following region: QDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE