Rabbit polyclonal FGA Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 116-144 amino acids from the N-terminal region of human FGA. |
Rabbit Polyclonal Anti-FGA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGA antibody: synthetic peptide directed towards the N terminal of human FGA. Synthetic peptide located within the following region: MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS |
Germany
Japan
United Kingdom
China
