Germany
Japan
United Kingdom
China
Rabbit Polyclonal FALDH Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PNPLA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNPLA3 antibody: synthetic peptide directed towards the C terminal of human PNPLA3. Synthetic peptide located within the following region: CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS |
Rabbit polyclonal YOD1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Zebrafish, Chicken) |
| Conjugation | Unconjugated |
| Immunogen | This YOD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 319-347 amino acids from the C-terminal region of human YOD1. |
Rabbit polyclonal HADHA Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HADHA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 737-763 amino acids from the C-terminal region of human HADHA. |
Rabbit Polyclonal Antibody against ALDH2 (Center)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2. |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Pathways
- Limonene and pinene degradation