Antibodies

Jump to Filters
View as table Download
KAT3A / CBP (CREBBP) Rabbit Polyclonal Antibody
TA322757

USD 380.00

In Stock

Anti-CREBBP Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 160-176 amino acids of Human
KAT3A / CBP (CREBBP) Rabbit Polyclonal Antibody
TA313691

USD 380.00

In Stock

Rabbit polyclonal anti-CREB-BP antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CREB-BP.
KAT3A / CBP (CREBBP) Rabbit Polyclonal Antibody
TA332223

USD 539.00

5 Days

Rabbit Polyclonal Anti-CREBBP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CREBBP Antibody: synthetic peptide directed towards the N terminal of human CREBBP. Synthetic peptide located within the following region: TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS