Antibodies

Jump to Filters
View as table Download
IL1 beta (IL1B) Rabbit Polyclonal Antibody
TA336742

USD 550.00

2 Weeks

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584]
RANTES (CCL5) Rabbit Polyclonal Antibody
AP20618PU-N

USD 445.00

3 Weeks

RANTES (CCL5) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 50-100 of Human RANTES.
IL1 alpha (IL1A) Rabbit Polyclonal Antibody
TA349352

USD 380.00

In Stock

Rabbit Polyclonal Anti-IL1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IL1A
C1QC Rabbit Polyclonal Antibody
TA324448

USD 580.00

5 Days

Rabbit polyclonal C1QC Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This C1QC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-120 amino acids from the Central region of human C1QC.
IL1 beta (IL1B) Rabbit Polyclonal Antibody
AP20628PU-N

USD 465.00

3 Weeks

IL1 beta (IL1B) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 131-180 of Human IL-1 Beta
IL6 (Center) Rabbit Polyclonal Antibody
AP52199PU-N

USD 580.00

2 Weeks

IL6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 26-55 amino acids from the Central region of Human Interleukin-6
Complement C7 (C7) (Center) Rabbit Polyclonal Antibody
AP50662PU-N

USD 580.00

2 Weeks

Complement C7 (C7) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 375-403 amino acids from the Center region of human C7
Laminin gamma 1 (LAMC1) Rabbit Polyclonal Antibody
AP20488PU-N

USD 445.00

3 Weeks

Laminin gamma 1 (LAMC1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
C1QC Rabbit Polyclonal Antibody
TA326232

USD 380.00

4 Weeks

Rabbit polyclonal C1QC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human C1QC.
C1QC Rabbit Polyclonal Antibody
AP21152PU-N

USD 465.00

In Stock

C1QC rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Complement Component 6 (C6) Rabbit Polyclonal Antibody
TA313533

USD 380.00

4 Weeks

Rabbit polyclonal anti-C6 (complement component 6) antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human C6.
Complement factor 8 beta (C8B) Rabbit Polyclonal Antibody
TA334645

USD 539.00

5 Days

Rabbit Polyclonal Anti-C8B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C8B antibody: synthetic peptide directed towards the middle region of human C8B. Synthetic peptide located within the following region: WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSA
Complement factor 8 beta (C8B) Rabbit Polyclonal Antibody
TA334646

USD 539.00

5 Days

Rabbit Polyclonal Anti-C8B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C8B antibody: synthetic peptide directed towards the C terminal of human C8B. Synthetic peptide located within the following region: SGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTL
C1QB Rabbit Polyclonal Antibody
TA335243

USD 539.00

5 Days

Rabbit Polyclonal Anti-C1QB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1QB antibody: synthetic peptide directed towards the C terminal of human C1QB. Synthetic peptide located within the following region: AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
IL6 Rabbit Polyclonal Antibody
TA341223

USD 515.00

5 Days

Rabbit Polyclonal Anti-IL6 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen IL6 antibody was raised against synthetic 18 amino acid peptide from internal region of human IL-6. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%).