Rabbit Polyclonal anti-NR5A1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR5A1 antibody: synthetic peptide directed towards the middle region of human NR5A1. Synthetic peptide located within the following region: AVPGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGP |
Rabbit Polyclonal Anti-NR5A1 Antibody (Ligand-binding Domain)
| Applications | IHC |
| Reactivities | Human (Predicted: Mouse, Rat, Dog, Hamster, Horse, Pig) |
| Conjugation | Unconjugated |
| Immunogen | NR5A1 / SF1 antibody was raised against synthetic 16 amino acid peptide from ligand-binding domain of human NR5A1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Mouse, Rat, Hamster, Elephant, Dog, Horse, Pig (94%); Monkey, Sheep, Panda, Bovine, Rabbit (88%); Opossum, Platypus (81%). |
Rabbit Polyclonal Anti-NR5A1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human (Predicted: Bovine, Dog, Horse, Pig, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | NR5A1 / SF1 antibody was raised against synthetic 17 amino acid peptide from internal region of human NR5A1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat (100%); Elephant, Panda, Dog, Bovine, Rabbit, Horse, Pig (94%); Mouse, Rat, Hamster (88%); Turkey, Chicken, Platypus, Xenopus (82%). |
Germany
Japan
United Kingdom
China
