Anti-SLC18A2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 500-514 amino acids of human solute carrier family 18 (vesicular monoamine), member 2 |
Rabbit Polyclonal Anti-SLC18A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC18A2 Antibody: synthetic peptide directed towards the N terminal of human SLC18A2. Synthetic peptide located within the following region: NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT |
Germany
Japan
United Kingdom
China
