Antibodies

Jump to Filters
View as table Download
GRPR Rabbit Polyclonal Antibody
TA316872

USD 515.00

2 Weeks

GRPR Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Bat, Dog, Gorilla, Human, Monkey, Pig, Rabbit, Gibbon, Horse (Predicted: Bovine)
Conjugation Unconjugated
Immunogen GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%).
Dopamine Receptor D4 (DRD4) Rabbit Polyclonal Antibody
TA321201

USD 380.00

2 Weeks

Anti-DRD4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-15 amino acids of Human Dopamine receptor D4
VR1 (TRPV1) Rabbit Polyclonal Antibody
TA336871

USD 550.00

Backordered

Rabbit Polyclonal Vanilloid R1/TRPV1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the rat TRPV1 protein (between residues 1-50) [UniProt O35433]
GABA A Receptor alpha 5 (GABRA5) Rabbit Polyclonal Antibody
TA338505

USD 539.00

5 Days

Rabbit Polyclonal Anti-GABRA5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW
EDG1 (S1PR1) Rabbit Polyclonal Antibody
TA306649

USD 570.00

2 Weeks

Rabbit Polyclonal S1P1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1.
Melatonin Receptor 1A (MTNR1A) Rabbit Polyclonal Antibody
TA321735

USD 380.00

4 Weeks

Anti-MTNR1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 130-144 amino acids of human melatonin receptor 1A
P2Y1 (P2RY1) Rabbit Polyclonal Antibody
TA328626

USD 850.00

2 Weeks

Rabbit Polyclonal Anti-P2Y1 Receptor (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide SDEYLRSYFIYSMC, corresponding to amino acid residues 207-220 of human P2Y1 Receptor. 2nd extracellular loop.
P2RY5 (LPAR6) (Center) Rabbit Polyclonal Antibody
AP52517PU-N

USD 580.00

2 Weeks

P2RY5 (LPAR6) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 106-134 amino acids from the Central region of Human P2RY5 / LPAR6
P2X1 (P2RX1) Rabbit Polyclonal Antibody
TA329003

USD 850.00

3 Weeks

Rabbit polyclonal Anti-P2X1 Receptor (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CRPIYEFHGLYEEK, corresponding to amino acid residues 270-283 of human P2X1 receptor . Extracellular loop.
CRLR (CALCRL) Rabbit Polyclonal Antibody
TA351107

USD 380.00

In Stock

Rabbit Polyclonal Anti-CALCRL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CALCRL
Somatostatin Receptor 3 (SSTR3) Rabbit Polyclonal Antibody
TA323276

USD 380.00

In Stock

Anti-SSTR3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 405-418 amino acids of human somatostatin receptor 3
Proteinase Activated Receptor 4 (F2RL3) Rabbit Polyclonal Antibody
TA328629

USD 850.00

3 Weeks

Rabbit Polyclonal Anti-Protease-activated Receptor-4 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)HLRGQRWPFGEAA(S)R, corresponding to amino acid residues 136-150 of human PAR-4. Cys 149 was replaced with Ser. 1st extracellular loop.
Dopamine D2 Receptor (DRD2) Rabbit Polyclonal Antibody
TA316680

USD 515.00

5 Days

Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Chimpanzee, Gorilla, Human (Predicted: Monkey, Rabbit)
Conjugation Unconjugated
Immunogen DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%).
GLP1R Rabbit Polyclonal Antibody
TA336864

USD 550.00

2 Weeks

Rabbit Polyclonal GLP-1R Antibody

Applications Dot, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human GLP1R protein (between residues 250-350) [UniProt P43220]
TSH Receptor (TSHR) Rabbit Polyclonal Antibody
TA321116

USD 380.00

In Stock

Anti-TSHR Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 21-253 amino acids of human thyroid stimulating hormone receptor