Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Dog, Pig, Rat, Xenopus, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal Anti-SHH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Chicken |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT |
Caspase 3 (CASP3) (full length) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Yeast |
| Conjugation | Unconjugated |
| Immunogen | Recombinant human Caspase-3 protein (full length) |
Germany
Japan
United Kingdom
China
