Antibodies

Jump to Filters
View as table Download
TJP1 Rabbit Polyclonal Antibody
TA341679

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-TJP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS
ATP6V1H Rabbit Polyclonal Antibody
TA315487

USD 380.00

4 Weeks

Rabbit polyclonal anti-ATP6V1H antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATP6V1H.