Antibodies

View as table Download

Rabbit Polyclonal Anti-Egr1 Antibody

Applications IHC, WB
Reactivities Mouse, Xenopus
Conjugation Unconjugated
Immunogen The immunogen for anti-Egr1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQV

Rabbit polyclonal anti-EGR-1 antibody

Applications IHC, WB
Reactivities Human, Chimpanzee, Mouse
Conjugation Unconjugated
Immunogen This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 94-108 (eqpyehltaesfpdi) of Human EGR-1.