Antibodies

Jump to Filters
View as table Download
Aldehyde dehydrogenase 10 (ALDH3A2) Rabbit Polyclonal Antibody
TA590756

USD 482.00

In Stock

Rabbit Polyclonal FALDH Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
ALDH6A1 Rabbit Polyclonal Antibody
TA324300

USD 380.00

In Stock

Anti-ALDH6A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1
ALDH6A1 Rabbit Polyclonal Antibody
TA324301

USD 380.00

In Stock

Anti-ALDH6A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1
Aldehyde dehydrogenase 10 (ALDH3A2) Rabbit Polyclonal Antibody
TA350577

USD 380.00

In Stock

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ALDH3A2
Aldehyde dehydrogenase 10 (ALDH3A2) Rabbit Polyclonal Antibody
TA335228

USD 539.00

5 Days

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG