Antibodies

Jump to Filters
View as table Download
Frizzled 9 (FZD9) Rabbit Polyclonal Antibody
TA314730

USD 380.00

2 Weeks

Rabbit polyclonal anti-FZD9 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human FZD9.
Frizzled 2 (FZD2) Rabbit Polyclonal Antibody
TA313900

USD 380.00

In Stock

Rabbit polyclonal anti-FZD2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD2.
Frizzled 6 (FZD6) Rabbit Polyclonal Antibody
TA314727

USD 380.00

4 Weeks

Rabbit polyclonal anti-FZD6 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD6.
Frizzled 5 (FZD5) Rabbit Polyclonal Antibody
TA311714

USD 380.00

In Stock

Rabbit polyclonal anti-FZD5 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD5.
FZD3 Rabbit Polyclonal Antibody
TA314709

USD 380.00

In Stock

Rabbit polyclonal anti-FZD3 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD3.
Frizzled 10 (FZD10) Rabbit Polyclonal Antibody
TA356128

USD 539.00

5 Days

FZD10 Antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH
FZD3 Rabbit Polyclonal Antibody
TA314708

USD 380.00

4 Weeks

Rabbit polyclonal anti-FZD3 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD3.
Frizzled 5 (FZD5) Rabbit Polyclonal Antibody
TA314704

USD 380.00

4 Weeks

Rabbit polyclonal anti-FZD5 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD5.
Frizzled 4 (FZD4) Rabbit Polyclonal Antibody
TA312351

USD 380.00

In Stock

Rabbit polyclonal anti-FZD4 antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD4.
Frizzled 4 (FZD4) Rabbit Polyclonal Antibody
TA312352

USD 380.00

4 Weeks

Rabbit polyclonal anti-FZD4 antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD4.