Rabbit Polyclonal Anti-TAAR5 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAAR5 antibody: synthetic peptide directed towards the middle region of human TAAR5. Synthetic peptide located within the following region: GWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKA |
Rabbit Polyclonal antibody to TAAR5 (trace amine associated receptor 5)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Chimpanzee, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 273 and 337 of TAAR5 (Uniprot ID#O14804) |
Rabbit Polyclonal Anti-TAAR5 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAAR5 antibody: synthetic peptide directed towards the C terminal of human TAAR5. Synthetic peptide located within the following region: TTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITP |
Germany
Japan
United Kingdom
China
