Antibodies

Jump to Filters
View as table Download
NONO Rabbit Polyclonal Antibody
TA343779

USD 485.00

5 Days

Rabbit Polyclonal Anti-NONO Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NONO antibody: synthetic peptide directed towards the C terminal of human NONO. Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY
NONO Rabbit Polyclonal Antibody
TA343778

USD 485.00

5 Days

Rabbit Polyclonal Anti-NONO Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NONO antibody: synthetic peptide directed towards the N terminal of human NONO. Synthetic peptide located within the following region: KQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLK