Antibodies

Jump to Filters
View as table Download
PYCR2 Rabbit Polyclonal Antibody
TA334474

USD 539.00

5 Days

Rabbit Polyclonal Anti-PYCR2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PYCR2 antibody: synthetic peptide directed towards the middle region of human PYCR2. Synthetic peptide located within the following region: LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE