Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human sTNF Receptor Type I |
Rabbit Polyclonal ASK1 Antibody
Applications | ELISA, ICC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ASK1 antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human ASK1 This sequence is different from that of mouse by last two amino acids. |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Biotinylated Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | E.coli derived Recombinant Human sTNF Receptor Type I |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Rabbit Polyclonal eNOS Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal eNOS Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Caspase 3 (CASP3) (p17) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Bcl2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |