Primary Antibodies

View as table Download

CHAF1B mouse monoclonal antibody, clone OTI4F7 (formerly 4F7)

Applications IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CHAF1B mouse monoclonal antibody, clone OTI4F7 (formerly 4F7)

Applications IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

CHAF1B mouse monoclonal antibody,clone 4F7, Biotinylated

Applications IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Biotin

CHAF1B mouse monoclonal antibody,clone 4F7, HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation HRP

Carrier-free (BSA/glycerol-free) CHAF1B mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-CHAF1B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CHAF1B antibody: synthetic peptide directed towards the N terminal of human CHAF1B. Synthetic peptide located within the following region: KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD

CHAF1B mouse monoclonal antibody, clone OTI4F7 (formerly 4F7)

Applications IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit polyclonal anti-CAF1B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CAF1B.

Rabbit Polyclonal Anti-CHAF1B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHAF1B antibody: synthetic peptide directed towards the C terminal of human CHAF1B. Synthetic peptide located within the following region: PPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP

Mouse Monoclonal CHAF1B Antibody (SS 24 1-68)

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated

Mouse Monoclonal Antibody against CAF-1 p60 (SS 53)

Applications ICC/IF, IP, WB
Reactivities Human
Conjugation Unconjugated

CHAF1B mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".