Primary Antibodies

Jump to Filters
View as table Download
NCAM2 (C-term) Goat Polyclonal Antibody
AP32136PU-N

USD 520.00

5 Days

NCAM2 (C-term) goat polyclonal antibody, Aff - Purified

Applications IF, IHC
Reactivities Bovine, Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence from the C-Terminus of the protein sequence according to NP_004531.2.
NCAM2 Rabbit Polyclonal Antibody
TA314232

USD 380.00

4 Weeks

Rabbit polyclonal anti-NCAM2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NCAM2.
NCAM2 Rabbit Polyclonal Antibody
AP21201PU-N

USD 465.00

3 Weeks

NCAM2 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NCAM2 Rabbit Polyclonal Antibody
TA339422

USD 539.00

5 Days

Rabbit Polyclonal Anti-NCAM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCAM2 antibody: synthetic peptide directed towards the middle region of human NCAM2. Synthetic peptide located within the following region: KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPIL
NCAM2 Rabbit Polyclonal Antibody
TA361452

USD 539.00

5 Days

NCAM2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NCAM2