Primary Antibodies

Jump to Filters
View as table Download
C11orf73 (HIKESHI) (N-term) Rabbit Polyclonal Antibody
AP50933PU-N

USD 580.00

2 Weeks

C11orf73 (HIKESHI) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Hamster, Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 9-39 amino acids from the N-terminal region of human CK073
C11orf73 (HIKESHI) Rabbit Polyclonal Antibody
TA345028

USD 539.00

5 Days

Rabbit Polyclonal Anti-C11orf73 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C11orf73 antibody: synthetic peptide directed towards the middle region of human C11orf73. Synthetic peptide located within the following region: DNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK
C11orf73 (HIKESHI) Rabbit Polyclonal Antibody
TA345029

USD 539.00

5 Days

Rabbit Polyclonal Anti-C11orf73 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-l7Rn6 antibody is: synthetic peptide directed towards the N-terminal region of Rat l7Rn6. Synthetic peptide located within the following region: GKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQT