Primary Antibodies

View as table Download

MAX mouse monoclonal antibody,clone OTI1D6

Applications WB
Reactivities Human
Conjugation Unconjugated

MAX mouse monoclonal antibody,clone OTI14G1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

MAX mouse monoclonal antibody,clone OTI5F5

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

MAX mouse monoclonal antibody,clone OTI6H1

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAX mouse monoclonal antibody,clone OTI1D6

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAX mouse monoclonal antibody,clone OTI14G1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAX mouse monoclonal antibody,clone OTI5F5

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAX mouse monoclonal antibody,clone OTI6H1

Applications WB
Reactivities Human
Conjugation Unconjugated

Goat Polyclonal Antibody against MAX

Applications WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EEPQSRKKLRMEAS, from the C Terminus of the protein sequence according to NP_002373.

Rabbit Polyclonal Anti-MAX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAX antibody: synthetic peptide directed towards the n terminal of human MAX. Synthetic peptide located within the following region: MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKAS

Rabbit Polyclonal Anti-MAX Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAX Antibody: synthetic peptide directed towards the middle region of human MAX. Synthetic peptide located within the following region: LQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS

Rabbit Polyclonal Anti-MAX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAX antibody: synthetic peptide directed towards the n terminal of human MAX. Synthetic peptide located within the following region: MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKAS

MAX Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-1-160 of human MAX (NP_002373.3).
Modifications Unmodified

Phospho-MAX-S11 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around S11 of human MAX (NP_002373.3).
Modifications Phospho S11