Germany
Japan
United Kingdom
China
Enkephalin (PENK) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Birds, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic methionine enkephalin coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Primary Antibodies
View as table Download
Enkephalin (PENK) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic leucine enkephalin coupled to keyhole limpet hemocyanin (KLH) to bovine thyroglobulin and BSA with glutaraldehyde. |
Goat Polyclonal Antibody against PENK
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSHHQDGSDNEE, from the internal region of the protein sequence according to NP_006202.1. |
TA303308 is a possible alternative to AM01180PU-N.
Rabbit Polyclonal Anti-PENK Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PENK antibody: synthetic peptide directed towards the middle region of human PENK. Synthetic peptide located within the following region: DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG |
Active filters
Target Symbol
- ENKEPHALIN