Rabbit Polyclonal Anti-RAE1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAE1 antibody: synthetic peptide directed towards the C terminal of human RAE1. Synthetic peptide located within the following region: EQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEE |
Rabbit polyclonal antibody to RAE1 (RAE1 RNA export 1 homolog (S. pombe))
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Zebrafish, Xenopus, Pig, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 307 and 368 of RAE1 (Uniprot ID#P78406) |
Rabbit Polyclonal Anti-RAE1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAE1 antibody: synthetic peptide directed towards the C terminal of human RAE1. Synthetic peptide located within the following region: SACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK |
Goat Polyclonal Antibody against RAE1
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Pig, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NAAEELKPRNKK, from the C Terminus of the protein sequence according to NP_003601.1; NP_001015885.1. |
RAE1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-368 of human RAE1 (NP_003601.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
