Primary Antibodies

View as table Download

CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)

Applications IHC, WB
Reactivities Human, Dog, Monkey, Mouse
Conjugation Unconjugated

CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)

Applications IHC, WB
Reactivities Human, Dog, Monkey, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTH mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)

Applications IHC, WB
Reactivities Human, Dog, Monkey, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTH mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)

Applications IHC, WB
Reactivities Human, Dog, Monkey, Mouse
Conjugation Unconjugated

CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12), Biotinylated

Applications IHC, WB
Reactivities Human, Dog, Monkey, Mouse
Conjugation Biotin

CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12), HRP conjugated

Applications IHC, WB
Reactivities Human, Dog, Monkey, Mouse
Conjugation HRP

CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6), Biotinylated

Applications IHC, WB
Reactivities Human, Dog, Monkey, Mouse
Conjugation Biotin

CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6), HRP conjugated

Applications IHC, WB
Reactivities Human, Dog, Monkey, Mouse
Conjugation HRP

CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)

Applications IHC, WB
Reactivities Human, Dog, Monkey, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)

Applications IHC, WB
Reactivities Human, Dog, Monkey, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-CTH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTH antibody: synthetic peptide directed towards the C terminal of human CTH. Synthetic peptide located within the following region: ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK

Rabbit Polyclonal Anti-CTH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTH antibody: synthetic peptide directed towards the N terminal of human CTH. Synthetic peptide located within the following region: VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF