Rabbit Polyclonal Anti-CRLF2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CRLF2 |
Rabbit Polyclonal Anti-CRLF2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CRLF2 |
CRLF2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CRLF2 |
CRLF2 rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated corresponding to a 19 amino acid peptide from near the center of Human CRLF2. |
Rabbit Polyclonal TSLP Receptor Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TSLP Receptor antibody was raised against a 19 amino acid peptide from near the center of human TSLP receptor. |
CRLF2 mouse monoclonal antibody, clone 8H8, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Polyclonal TSLP R/CRLF2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Amino acids 119-231 of human TSLPR protein were used as the immunogen for the antibody. |
Mouse Polyclonal TSLP R/CRLF2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Amino acids 119-231 of human TSLPR protein were used as the immunogen for the antibody. |
Rabbit Polyclonal TSLP Receptor Antibody
Applications | IF, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | TSLP receptor antibody was raised against a 21 amino acid peptide from near the center of mouse TSLP receptor. |
Mouse Monoclonal TSLP R/CRLF2 Antibody (59N5G4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CRLF2 mouse monoclonal antibody, clone AT4E7, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CRLF2 mouse monoclonal antibody, clone AT4E7, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CRLF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CRLF2 Antibody: synthetic peptide directed towards the middle region of human CRLF2. Synthetic peptide located within the following region: FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF |
CRLF2 Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse CRLF2 |
CRLF2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-231 of human CRLF2 (NP_071431.2). |
Modifications | Unmodified |