Primary Antibodies

View as table Download

C11orf73 (HIKESHI) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Hamster, Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 9-39 amino acids from the N-terminal region of human CK073

Rabbit Polyclonal Anti-C11orf73 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C11orf73 antibody: synthetic peptide directed towards the middle region of human C11orf73. Synthetic peptide located within the following region: DNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK