Goat Anti-MON1A (aa478-489) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence HISYLEPDTDLC, from the internal region of the protein sequence according to NP_115731.2; NP_001135973.1. |
Rabbit Polyclonal Anti-MON1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MON1A antibody: synthetic peptide directed towards the C terminal of human MON1A. Synthetic peptide located within the following region: GIPDLRHFLYKSKSSGLFTSPEIEAPYTSEEEQERLLGLYQYLHSRAHNA |
Goat Anti-MON1A (aa589-601) Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RPLKTIYYTGPNE, from the internal region of the protein sequence according to NP_115731.2; NP_001135973.1. |
Goat Polyclonal Anti-ATG4A Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATG4A Antibody: Peptide with sequence TEENGTVNDQTFHC, from the internal region of the protein sequence according to NP_443168.2; NP_840054.1. |
Rabbit anti SAND1 (Mona) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from a portion of the intra domain 190-240aa of human Mon1a protein. This sequence is identical to human, mouse, rat, bovine and chicken. |
MON1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MON1A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MON1A. |
Germany
Japan
United Kingdom
China
