Germany
Japan
United Kingdom
China
HLA-DQA2 mouse monoclonal antibody,clone OTI3E6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Primary Antibodies
View as table Download
HLA-DQA2 mouse monoclonal antibody,clone OTI4C9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HLA-DQA2 mouse monoclonal antibody,clone OTI3E6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HLA-DQA2 mouse monoclonal antibody,clone OTI4C9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
HLA-DQA2 mouse monoclonal antibody,clone OTI3E6, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 509.00
2 Weeks
HLA-DQA2 mouse monoclonal antibody,clone OTI3E6, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 509.00
2 Weeks
HLA-DQA2 mouse monoclonal antibody,clone OTI4C9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 509.00
2 Weeks
HLA-DQA2 mouse monoclonal antibody,clone OTI4C9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
HLA-DQA2 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_064440.1. |
Goat Anti-HLA-DQA2 & HLA-DQA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QGLRSVGASRH, from the C Terminus of the protein sequence according to NP_064440.1; NP_002113.2. |
Rabbit polyclonal Anti-HLA-DQA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the N terminal of human HLA-DQA2. Synthetic peptide located within the following region: GVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQS |
Rabbit polyclonal Anti-HLA-DQA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the middle region of human HLA-DQA2. Synthetic peptide located within the following region: LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK |
HLA-DQA2 mouse monoclonal antibody,clone OTI3E6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HLA-DQA2 mouse monoclonal antibody,clone OTI4C9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- HLA-DQA2
Reactivities
- Human