Primary Antibodies

Jump to Filters
View as table Download
ALAS1 Mouse Monoclonal Antibody [Clone ID: OTI1C5]
TA808177

USD 447.00

In Stock

ALAS1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ALAS1 Mouse Monoclonal Antibody [Clone ID: OTI5D5]
TA808194

USD 447.00

In Stock

ALAS1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ALAS1 Mouse Monoclonal Antibody [Clone ID: OTI1C5]
CF808177

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) ALAS1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ALAS1 Mouse Monoclonal Antibody [Clone ID: OTI5D5]
CF808194

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) ALAS1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ALAS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C5]
TA808177AM

USD 509.00

2 Weeks

ALAS1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
ALAS1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C5]
TA808177BM

USD 509.00

2 Weeks

ALAS1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
ALAS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D5]
TA808194AM

USD 509.00

2 Weeks

ALAS1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
ALAS1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D5]
TA808194BM

USD 509.00

2 Weeks

ALAS1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
ALAS1 Rabbit Polyclonal Antibody
TA321180

USD 380.00

In Stock

Anti-ALAS1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 219 amino acids of human aminolevulinate, delta-, synthase 1
ALAS1 Rabbit Polyclonal Antibody
TA336353

USD 485.00

5 Days

Rabbit Polyclonal Alas1 Antibody

Applications IHC, Simple Western, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A portion of amino acids 480-530 of human ALAS-1 were used as the immunogen.
ALAS1 Rabbit Polyclonal Antibody
TA321181

USD 380.00

In Stock

Anti-ALAS1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 219 amino acids of human aminolevulinate, delta-, synthase 1
ALAS1 Rabbit Polyclonal Antibody
TA336223

USD 539.00

5 Days

Rabbit Polyclonal Anti-ALAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALAS1 Antibody: synthetic peptide directed towards the N terminal of human ALAS1. Synthetic peptide located within the following region: ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS