Primary Antibodies

Jump to Filters
View as table Download
FBXW8 (Center) Rabbit Polyclonal Antibody
AP51638PU-N

USD 580.00

2 Weeks

FBXW8 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 273-303 amino acids from the Central region of human FBXW8
FBXW8 Rabbit Polyclonal Antibody
TA330939

USD 539.00

5 Days

Rabbit polyclonal Anti-FBXW8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXW8 antibody: synthetic peptide directed towards the middle region of human FBXW8. Synthetic peptide located within the following region: MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHR
FBXW8 Rabbit Polyclonal Antibody
TA330940

USD 539.00

5 Days

Rabbit polyclonal Anti-FBXW8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXW8 antibody: synthetic peptide directed towards the middle region of human FBXW8. Synthetic peptide located within the following region: RNADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYD