Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
UBE2C (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human UBE2C |
Goat Anti-UBE2C / UBCH10 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SGDKGISAFPESDN, from the internal region of the protein sequence according to NP_008950.1; NP_861515.1; NP_861517.1. |
Rabbit Polyclonal Anti-UBE2C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2C antibody: synthetic peptide directed towards the N terminal of human UBE2C. Synthetic peptide located within the following region: ELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPS |
Rabbit Polyclonal Anti-UBE2C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2C antibody: synthetic peptide directed towards the middle region of human UBE2C. Synthetic peptide located within the following region: QGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNP |
Rabbit Polyclonal Anti-UBE2C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-UBE2C Antibody: synthetic peptide directed towards the middle region of human UBE2C. Synthetic peptide located within the following region: GTAVGSIRTSSTVCLLSGPRETQDSSKPLVWGLGWDMRLLLELTLQLFLQ |
UBE2C Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human UBE2C |
Active filters
Target Symbol
- UBE2C
Pathways
- Ubiquitin mediated proteolysis