Germany
Japan
United Kingdom
China
IL5 Rabbit monoclonal antibody,clone OTIR1G2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-IL5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL5 Antibody: synthetic peptide directed towards the middle region of human IL5. Synthetic peptide located within the following region: LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL |
Rabbit Polyclonal Anti-Interleukin 5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5 |
Mouse Monoclonal Anti-IL-5 Antibody
| Reactivities | Human, Macaque |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-5 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-5 Antibody
| Reactivities | Macaque, Monkey, Human |
| Conjugation | Unconjugated |
IL5 Rabbit monoclonal antibody,clone OTIR1G2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- IL5
Reactivities
- Human
Pathways
- T cell receptor signaling pathway