Primary Antibodies

Jump to Filters
View as table Download
UGT1A5 Rabbit Polyclonal Antibody
TA331083

USD 539.00

5 Days

Rabbit polyclonal Anti-UGT1A5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A5 antibody: synthetic peptide directed towards the N terminal of human UGT1A5. Synthetic peptide located within the following region: EENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNM
UGT1A5 Rabbit Polyclonal Antibody
TA360449

USD 539.00

5 Days

UGT1A5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human UGT1A5