Rabbit Polyclonal antibody to Trehalase (trehalase (brush-border membrane glycoprotein))
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rabbit, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 7 and 285 of Trehalase (Uniprot ID#O43280) |
Rabbit Polyclonal Anti-TREH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TREH antibody is: synthetic peptide directed towards the middle region of Human TREH. Synthetic peptide located within the following region: NYLLNRYYVPYGGPRPESYSKDVELADTLPEGDREALWAELKAGAESGWD |
TREH Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TREH |
Germany
Japan
United Kingdom
China
