MAX mouse monoclonal antibody,clone OTI14G1
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
MAX mouse monoclonal antibody,clone OTI14G1
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
MAX mouse monoclonal antibody,clone OTI5F5
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAX mouse monoclonal antibody,clone OTI14G1
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAX mouse monoclonal antibody,clone OTI5F5
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against MAX
Applications | WB |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EEPQSRKKLRMEAS, from the C Terminus of the protein sequence according to NP_002373. |
Rabbit Polyclonal Anti-MAX Antibody
Applications | WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MAX Antibody: synthetic peptide directed towards the middle region of human MAX. Synthetic peptide located within the following region: LQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS |
MAX mouse monoclonal antibody,clone OTI14G1
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MAX mouse monoclonal antibody,clone OTI5F5
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".