Germany
Japan
United Kingdom
China
RPL9 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 148-177 amino acids from the C-terminal region of Human RPL9 |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-RPL9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL9 antibody: synthetic peptide directed towards the C terminal of human RPL9. Synthetic peptide located within the following region: GVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIY |
Rabbit Polyclonal Anti-RPL9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL9 antibody: synthetic peptide directed towards the C terminal of human RPL9. Synthetic peptide located within the following region: ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE |
Active filters
Target Symbol
- RPL9
Pathways
- Ribosome