Primary Antibodies

Jump to Filters
View as table Download
RPL11 Rabbit Polyclonal Antibody
TA350369

USD 380.00

In Stock

Rabbit Polyclonal Anti-RPL11 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RPL11
RPL11 Rabbit Polyclonal Antibody
TA314458

USD 380.00

4 Weeks

Rabbit polyclonal anti-RPL11 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human RPL11.
RPL11 Rabbit Polyclonal Antibody
TA338284

USD 539.00

5 Days

Rabbit Polyclonal Anti-RPL11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL11 antibody is: synthetic peptide directed towards the C-terminal region of Human RPL11. Synthetic peptide located within the following region: DFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIILPGK
RPL11 (N-term) Rabbit Polyclonal Antibody
AP53706PU-N

USD 580.00

2 Weeks

RPL11 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human RPL11