Primary Antibodies

Jump to Filters
View as table Download
PI 3 Kinase regulatory subunit 4 (PIK3R4) Rabbit Polyclonal Antibody
TA350916

USD 380.00

In Stock

Rabbit Polyclonal Anti-PIK3R4 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIK3R4
PI 3 Kinase regulatory subunit 4 (PIK3R4) Mouse Monoclonal Antibody [Clone ID: OTI5D1]
TA800708S

USD 200.00

2 Days

PIK3R4 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PI 3 Kinase regulatory subunit 4 (PIK3R4) Rabbit Polyclonal Antibody
TA334554

USD 539.00

5 Days

Rabbit Polyclonal Anti-PIK3R4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIK3R4 antibody: synthetic peptide directed towards the N terminal of human PIK3R4. Synthetic peptide located within the following region: HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL