Primary Antibodies

Jump to Filters
View as table Download
DCP2 (Center) Rabbit Polyclonal Antibody
AP51202PU-N

USD 580.00

2 Weeks

DCP2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 151~181 amino acids from the Center region of Human DCP2
DCP2 Rabbit Polyclonal Antibody
TA320127

USD 570.00

5 Days

Rabbit Polyclonal DCP2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DCP2 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human DCP2.
DCP2 Rabbit Polyclonal Antibody
TA310110

USD 360.00

3 Weeks

Rabbit anti-DCP2 polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH
DCP2 Rabbit Polyclonal Antibody
TA344008

USD 539.00

5 Days

Rabbit Polyclonal Anti-DCP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCP2 antibody: synthetic peptide directed towards the middle region of human DCP2. Synthetic peptide located within the following region: KQYQDSPNQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLP
DCP2 Rabbit Polyclonal Antibody
TA344009

USD 539.00

5 Days

Rabbit Polyclonal Anti-DCP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCP2 antibody: synthetic peptide directed towards the C terminal of human DCP2. Synthetic peptide located within the following region: VEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGK