Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
USD 509.00
2 Weeks
USD 509.00
2 Weeks
PSMA1 mouse monoclonal antibody,clone OTI9H1
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PSMA1 mouse monoclonal antibody,clone OTI6C4
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-PSMA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the C terminal of human PSMA1. Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL |
Rabbit anti-PSMA1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSMA1 |
Rabbit Polyclonal Anti-PSMA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the N terminal of human PSMA1. Synthetic peptide located within the following region: MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALK |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- PSMA1
Pathways
- Proteasome